Essential Thrombocythemia, Polycythemia Vera
Conditions
Brief summary
A phase I-II study in patients with mutated MPN by vaccinating with PD-L1 and Aginase1 peptides with Montanide ISA-51 as adjuvant, to monitor the immunological response to vaccination and subsequently safety, toxicity and clinical effect.
Interventions
DRUGPD-L1 peptide: PD-L1 Long(19-27) Peptide sequence: FMTYWHLLNAFTVTVPKDL
Peptide vaccination
DRUGArginase1 peptide: ArgLong2(169-206) Peptide sequence ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL
Peptide vaccination
Sponsors
Inge Marie Svane
Study design
Allocation
NA
Intervention model
SINGLE_GROUP
Primary purpose
TREATMENT
Masking
NONE
Eligibility
Sex/Gender
ALL
Age
18 Years to No maximum
Healthy volunteers
No
Inclusion criteria
* 1\. Diagnosis of essential thrombocythemia or Polycythemia Vera, according to the WHO criteria123,124 2. Age ≥18 years 3. Performance status ≤ 2 (ECOG-scale) 4. Expected survival \> 3 months 5. Sufficient bone marrow function 6. Creatinine \< 2.5 upper normal limit, i.e. \< 300 µmol/l 7. Sufficient liver function, i.e. 1. ALAT \< 2.5 upper normal limit, i.e. ALAT \<112 U/l 2. Bilirubin \< 30 U/l 8. For women: Agreement to use contraceptive methods with a failure rate of \< 1% per year during the treatment period and for at least 120 days after the last treatment. 9\. For men: Agreement to use contraceptive measures and agreement to refrain from donating sperm.
Exclusion criteria
1. Other malignancies in the medical history excluding basal cell carcinoma. Patients cured for another malignant disease with no sign of relapse five years after ended treatment is allowed to enter the protocol. 2. Significant medical condition per investigators judgement e.g. severe Asthma/COPD, poorly regulated heart condition, insulin dependent diabetes mellitus. 3. Acute or chronic viral or bacterial infection e.g. HIV, hepatitis or tuberculosis 4. Serious known allergies or earlier anaphylactic reactions. 5. Known sensibility to Montanide ISA-51 6. Any active autoimmune diseases e.g. autoimmune neutropenia, thrombocytopenia or hemolytic anemia, systemic lupus erythematosus, scleroderma, myasthenia gravis, autoimmune glomerulonephritis, autoimmune adrenal deficiency, autoimmune thyroiditis etc. 7. Pregnant and breastfeeding women. 8. Fertile women not using secure contraception with a failure rate less than \< 1% 9. Patients taking immune suppressive medications incl. systemic corticosteroids and methotrexate at the time of enrollment 10. Psychiatric disorders that per investigator judgment could influence compliance. 11. Treatment with other experimental drugs 12. Treatment with other anti-cancer drugs - except IFN-a, hydroxyurea or anagrelide. 13. Treatment with ruxolitinib. 14. Treatment with chemotherapy or immune therapy (excluding IFN-a, hydroxyurea or anagrelide) within the last 28 days.
Design outcomes
Primary
| Measure | Time frame | Description |
|---|---|---|
| Immune response | 1 year | T-cell cytokine release towards target antigens |
Secondary
| Measure | Time frame | Description |
|---|---|---|
| Adverse events evaluated by CTCAE v. 5.0 | 1 year | Adverse events are graded 1-5 according to the criteria |
| Clinical response | 10 year | Vaccinations will induce clinical response in 2 patients, either partial response or better, according response criteria for PV and ET or clinical response as a reduction of mutated allelic burden - 10% from baseline at any time. |
Countries
Denmark
Outcome results
None listed